PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun008451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family EIL
Protein Properties Length: 268aa    MW: 30116.5 Da    PI: 10.355
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Vun#S45819128PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3403.92e-123423630265
                X.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.... CS
       EIN3  30 aatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqter 129
                +a++++k ++s++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++raWWkekv+fd+ngpaai+ky+a++l++s+++++  ++
  Vun008451   4 QAAEKQKPRQSSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNIRAWWKEKVKFDKNGPAAIAKYEAECLAMSEADNS--RN 101
                568999*************************************************************************************99988..78 PP

                XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTT CS
       EIN3 130 sseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeireler 229
                 ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWPtG+e+ww++l l++ q+ ppykkphdlkk+wkv+vLtavikhmsp+i++ir+++r
  Vun008451 102 GNSQSILQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVPPPWWPTGNEDWWSQLNLPHGQS-PPYKKPHDLKKMWKVGVLTAVIKHMSPNIAKIRRHVR 200
                999999*******************************************************9.9************************************ PP

                TSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX CS
       EIN3 230 qskylqdkmsakesfallsvlnqeekecatvsahss 265
                qsk+lqdkm+akes+++l vl++ee+++++ s++s 
  Vun008451 201 QSKCLQDKMTAKESAIWLGVLSREEALIRQPSSDSG 236
                ******************************999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048739.2E-1204225No hitNo description
Gene3DG3DSA:1.10.3180.102.5E-72100233IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.15E-62106229IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
XIQQAAEKQK PRQSSDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  60
SSDNIRAWWK EKVKFDKNGP AAIAKYEAEC LAMSEADNSR NGNSQSILQD LQDATLGSLL  120
SSLMQHCDPP QRKYPLEKGV PPPWWPTGNE DWWSQLNLPH GQSPPYKKPH DLKKMWKVGV  180
LTAVIKHMSP NIAKIRRHVR QSKCLQDKMT AKESAIWLGV LSREEALIRQ PSSDSGTSGV  240
TGCYLVFLLR KQAASSAATM MLMVLMMX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A1e-771052369140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014498119.11e-177PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X2
SwissprotO231161e-145EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0S3SG821e-177A0A0S3SG82_PHAAN; Uncharacterized protein
TrEMBLV7BZ651e-177V7BZ65_PHAVU; Uncharacterized protein
STRINGGLYMA15G03650.11e-176(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-146ETHYLENE-INSENSITIVE3-like 3